Jˆ=xdA YA ščĆ銟×ģ ßķ īļń8ö<ų @üWżlžr’yź`˜ģXLX üX ¬X  X X \X¼XwX2PX°“Ų6°66|€(Ž8”¶9"l¶:?į¶=~>~ ?~(@~0F~8G~dXHÄXI$XX|Y„\¤X]ƒX^ˆč b‰ d‰§e‰¬f‰±k‰³l‰ŗt‰ŠXu‹0XvŒ wŽ\Xx¼Xy‘łz•{•XCØŖK d źéQ8:źæ,(o;ˆ?HWwM|'M Cļ.ž)Ś©ĶTŁų3 ¾^ŹĆh› žŸw÷0?’§ŖR /dev/null 2>&1 || :if [ $1 = 1 ]; then /sbin/chkconfig --add mysqld fi /bin/chmod 0755 /var/lib/mysql /bin/touch /var/log/mysqld.logif [ $1 = 0 ]; then /sbin/chkconfig --del mysqld fiif [ $1 -ge 1 ]; then /sbin/service mysqld condrestart >/dev/null 2>&1 || : fis3åŚ±?ōšd”V-€ćŹ5[ŗA/ÖvŁ3yźxWś2šŌzoŖ¬›2Æ?CZn’~ń’個)ĀÜ=Q»%, ®zÅ’{­rļę(ų€9*ś‚'†’½_ ć q ‘ˆ ļéĖE+p!„HčØ*=Q»%, ®zĘ.ü%ÅžķķķķķķķķķķķķķķķķķķķķķķķķķķķķķķķķA큤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤¤ķA큠AķHW HW(HW(HW)HW)HW)HV HV HV HVHVHV HV HW(HW(HV HV HW)HV HVHV HV HW(HW)HW)HW(HW)HW(HW)HW(HW)HW)HWUH>ŠH>ŠH>ŠH>ŠH>ŠHV°HV±HV±HV±HV²HV²HV³HV“HV“HV“HVµHVµHVµHV¶HV¶HV·HV·HV·HVøHV¹HV¹HV¹HVŗHVŗHVŗHV»HV»HV¼HVĄHVĮHVĮHVĮHVĮHVĀHVĀHV„HV HWHWHWHWHWHV HV HV HV HWHW HWHW 069a2d09a56cab639d0e0f93755a0b6db3089fea00ff12bfdb3c58d4fd8108960528df71546ae8d4e185a0cac5019520cd45e16d09334225183a1c496a75993c71c5d6ef45a890284b7174b503927301d2824f007fb9cfb9b7c24b4d6c4a59731564bcc035c4f0476f9b593cbec175c23818ec612394c30d94c33187d86541fe1dda172de080c1fd63e9dd9a7fcd166bd380641b2a6b9ba12f56c2a08e2376d670a7974ebbd42820ebbfccb4ef6dc73c540ef91785bec93508ca155588a8d09c5c080244bd2fb2f96572b8f4810f1a0a674b3a5293083b07d4ffff063a9bb3b76a5b5ec5f992d7bbe7d71ac09d507d4a85dbfcc5e8457c4f815d4cfc5d9e8ad993104374c15dddee8f7d1ac15fa01ed1731a14443c3c2e710ea9f803c1f3cc9d8fd27c20b2e44b0a54288a63512fa0e2d1f86a277274cfd98087023c38271caa6b1958c61616c161ef5154e93bf4e862331d3722d2043b10c8ee87826b25f872a53f4e6cf4ddf4247ff2b903dda186a203d51d654cf69d2708b13d5c42c6f8795a1daa5bd809b554412b6f33aa3b29d12a6657a5d3c3f6a0bc337ffdb0adb1a8aa99a9306a077e9c84da807d4e482717c0276901ff27589dc77f86ba9a73e9d9ce02230799523b98035f1f8b978f22b33dc4f66a2599e9541fbfd39d54103d9121222a404e28b4a846fa2c2fad739b40b333c500dd22ccdcc1fe872a96615a5d6df34244894a3ac9fca84e3b1d444a1b4add1e0f40db8dc7b979ad32997b92e0c28f22e9f54666d071e5be8d31e785441ecb2794c374f0e47d9dad449209528d57a13f3b06d110c58203180bc892ac96516fa96dfc2fcfcfea968afb79501a30b14262d06e202fedc1417b1fc3dde6244f6f05eba313e71556b4e6a8f3fffdf1ce2cce46dd47b492cae396d3ca51253680198b930d57409065a8474c81392f65206a2b1fce5c9815ee7fc676e278c426f7b9739403e73f877b017c187609a57efc2e5cadc1679f6ca91a92a43d6455ee8d3740bb590c551d043e6ad35d5c60a37e9216906e32d67684903a840257d451a77adc8dd026fb8f9602625c9ce0c3c58942b51914932c394ac1250f0d11f4c9ff7e25b6a24695ab9a8af10246bea73fb68c78cf4e585d24a4d8f69816102b1210fa7e5f2f392f0e70a47bfc142c34a17ce69b7691c725dd9ad1d56ae110c7815a9c1fb9b778c93c3666f1aa5df9b6a8e2951755b3f1a64e942c1d09e02b451c5332a9f1ce35d2b10a61c0ee357a894762ee2d356d565423861da4b74225ef4548eb906a49882581b44070f6ee1f3617ac38648a8f776df320c07887e74314756eb435c14a06a9d3a4527ec317e9d2b81bed57d343f7daf3c1eb0b298cd91ad7ef9e47d9d301ce39482d8bcf303878ff235ffdbdee29e073c4f7757b4bbcabd09cbb556a31913124b3ac336ac8807c97b18fc2e42554f710e2984b3e31d6834a92a4dd4081fafbc7fa1e21a6c8ccdaa3df84fc44da3a1b983d795cb3f264214b4df99e59461b1fec904cd29196200f1a8f245e9da92e7abc23ddb6b65088e74ede6f45c17d91c4ff3523859fda0acae81d309865f3c0976716a53eaf67e033ba558f0bff9717612875ccf711b0fb6b50244ef065b53990fe64213a2a3f2eae0f980775e937b30119cc68499f3de7bc876df34244894a3ac9fca84e3b1d444a1b4add1e0f40db8dc7b979ad32997b92e0c28f22e9f54666d071e5be8d31e785441ecb2794c374f0e47d9dad449209528d57a13f3b06d110c58203180bc892ac966705dde9fcd1aae9464a7a29ac2585e1c700d8539568a5b19e2b13552b248c4a8f41fc68d721ba3f904ab675b9a4fc05a4c153a5eb65d92ef6a1e52dbc61a40e74fe29530343ae0191e39d9011b454b1d41d8cd98f00b204e9800998ecf8427erootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlmysqlmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlmysqlmysqlmysql-5.0.58-jason.2.src.rpm’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’Ü’’’’‰MČconfig(mysql-server)mysql-server@@@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@JJ@/bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/sbin/chkconfig/usr/bin/perl/usr/sbin/useraddconfig(mysql-server)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.2.5)(64bit)libcrypto.so.6()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libmysqlclient.so.15()(64bit)libmysqlclient.so.15(libmysqlclient_15)(64bit)libmysqlclient_r.so.15()(64bit)libmysqlclient_r.so.15(libmysqlclient_15)(64bit)libnsl.so.1()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)librt.so.1()(64bit)libssl.so.6()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libz.so.1()(64bit)mysqlperl(DBI)perl(Data::Dumper)perl(File::Basename)perl(File::Copy)perl(File::Path)perl(File::Temp)perl(Getopt::Long)perl(POSIX)perl(Sys::Hostname)perl(strict)perl(vars)perl(warnings)perl-DBD-MySQLperl-DBIrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)sh-utils5.0.58-jason.25.0.58-jason.23.0.4-14.0-1MySQL-server4.4.2H%`Gń^ąGĒ.ąG¬ŠąGrĪąGYĀ`Fé²ąFča`F·™ąF–¤`F‰u`Fqŗ`FC•ąF;¬ąF·`FĀąFB`EńŲąEš‡`EĢīąES¤ąDµpąD‹@ąDˆąDWÖ`DV„ąD(``Cķ ąCė»`Cé`C½–ąC”ē`C”ē`C •ąCņąC™ž`CyąCrq`Cjˆ`CDLąC œ`BŌ=`BŅėąBŻ`Bmh`BVžąBU­`B2ąB+}`B*+ąBe`Aé’`AåąAåąAȜąA¾ąA¼æ`AƐ`A£²ąA‚½`AkąA€`AlSąAdjąAc`@Ļq`@Øą@Wxą@Eą@;É`@-Hą?ŗ–`?•`?•`?k|`?f6`?KŲ`?Uą>šąą>Žką>ւą>Õ1`>¼$ą>xč`>R¬ą>/`>#6ą>Y`>dą>5ą=’ž`=žLą=łą=Ś“`=Ńyą=}ą=v‚`=n™`=f°`=UŒą=<€`=7:`=-’ą=9`=”ą=!`<ö ą<ķf`<ą7`<²ąąˆą:"Ł`:µą:’`:’`9’@ą9÷Wą9ō“ą9ī`9ģĖą9׳ą9Ń`9¾§`9¶¾`9©`9„šą9›ą9—`9ŒŽ`9‡H`9€°ą9v$ą9tÓ`9są9o`9n;ą9lź`9lź`9jG`9hõą9g¤`9cÆą9_»`9]`8øLą8–ą88k`Jason Litka 5.0.58-jason.2Jason Litka 5.0.58-jason.1Jason Litka 5.0.56-jason.1Jason Litka 5.0.54-jason.2Jason Litka 5.0.54-jason.1Jason Litka 5.0.48-jason.3Jason Litka 5.0.48-jason.2Jason Litka 5.0.48-jason.1Jason Litka 5.0.46-jason.1Jason Litka 5.0.45-jason.1Jason Litka 5.0.44-jason.1Jason Litka 5.0.42-jason.1Jason Litka 5.0.41-jason.1Jason Litka 5.0.40-jason.1Jason Litka 5.0.38-jason.3Jason Litka 5.0.38-jason.2Jason Litka 5.0.38-jason.1Jason Litka 5.0.37-jason.1Jason Litka 5.0.36-jason.3Tom Lane 5.0.33-1Tom Lane 5.0.27-1Jesse Keating - 5.0.22-2.1Tom Lane 5.0.22-2Tom Lane 5.0.22-1Tom Lane 5.0.21-2Tom Lane 5.0.21-1Tom Lane 5.0.18-4Jesse Keating - 5.0.18-2.1Tom Lane 5.0.18-2Jesse Keating - 5.0.18-1.1Tom Lane 5.0.18-1Tom Lane 5.0.16-4Tom Lane 5.0.16-3Tom Lane 5.0.16-2Tom Lane 5.0.16-1Jesse Keating Tom Lane 5.0.15-3Tom Lane 5.0.15-2Tom Lane 5.0.15-1Tom Lane 4.1.14-1Tom Lane 4.1.12-3Tom Lane 4.1.12-2Tom Lane 4.1.12-1Tom Lane 4.1.11-4Tom Lane 4.1.11-3Tom Lane 4.1.11-2Tom Lane 4.1.11-1Tom Lane 4.1.10a-1Tom Lane 4.1.10-3Tom Lane 4.1.10-2Tom Lane 4.1.10-1Tom Lane 4.1.9-1Tom Lane 4.1.7-10Tim Waugh 4.1.7-9Tom Lane 4.1.7-8Tom Lane 4.1.7-7Tom Lane 4.1.7-6Tom Lane 4.1.7-5Tom Lane 4.1.7-4Tom Lane 4.1.7-3Tom Lane 4.1.7-2Tom Lane 4.1.7-1Tom Lane 3.23.58-13Tom Lane 3.23.58-12Tom Lane 3.23.58-11Elliot Lee 3.23.58-10Warren Togami 3.23.58-9Tom Lane 3.23.58-8Elliot Lee Tom Lane Elliot Lee Kim Ho 3.23.58-5Kim Ho 3.23.58-4Patrick Macdonald 3.23.58-3Patrick Macdonald 3.23.58-2Patrick Macdonald 3.23.58-1Patrick Macdonald 3.23.57-2Patrick Macdonald 3.23.57-1Patrick Macdonald 4.0.13-4Elliot Lee 4.0.13-3Patrick Macdonald 4.0.13-2Patrick Macdonald 4.0.13-1Patrick Macdonald 3.23.56-2Patrick Macdonald 3.23.56-1Patrick Macdonald 3.23.54a-11Tim Powers Karsten Hopp 3.23.54a-9Jeff Johnson 3.23.54a-8Bill Nottingham 3.23.54a-7Tim Powers 3.23.54a-6Elliot Lee 3.23.54a-5Joe Orton 3.23.54a-4Joe Orton 3.23.54-3Jakub Jelinek 3.23.52-5Florian La Roche Trond Eivind Glomsrųd 3.23.52-4Jakub Jelinek 3.23.52-3Trond Eivind Glomsrųd 3.23.52-2Trond Eivind Glomsrųd 3.23.52-1Elliot Lee 3.23.51-5Trond Eivind Glomsrųd 3.23.51-4Trond Eivind Glomsrųd 3.23.51-3Trond Eivind Glomsrųd 3.23.51-2Trond Eivind Glomsrųd 3.23.51-1Tim Powers Trond Eivind Glomsrųd 3.23.50-2Trond Eivind Glomsrųd 3.23.50-1Tim Powers Trond Eivind Glomsrųd 3.23.49-4Trond Eivind Glomsrųd 3.23.49-3Trond Eivind Glomsrųd 3.23.49-2Trond Eivind Glomsrųd 3.23.49-1Trond Eivind Glomsrųd 3.23.48-2Trond Eivind Glomsrųd 3.23.48-1Trond Eivind Glomsrųd 3.23.47-4Trond Eivind Glomsrųd 3.23.47-3Trond Eivind Glomsrųd 3.23.47-1Trond Eivind Glomsrųd 3.23.46-1Trond Eivind Glomsrųd 3.23.45-1Trond Eivind Glomsrųd 3.23.44-2Trond Eivind Glomsrųd 3.23.44-1Trond Eivind Glomsrųd 3.23.43-1Trond Eivind Glomsrųd 3.23.42-1Trond Eivind Glomsrųd 3.23.41-1Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Jakub Jelinek Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Bill Nottingham Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Prospector Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Trond Eivind Glomsrųd Jakub Jelinek Trond Eivind Glomsrųd Jos Vos Jos Vos Jos Vos - Added patches for bug #'s 32167 & 32942- Updated to BK sources for 5.0.58 - Removed patch for bug #33050- Updated to BK sources for 5.0.56 - Updated mysql-testing.patch - Removed discrete patch for yassl bug - Removed CentOS patch for Bug 33057 - Added patch for thread_stack testing failure (bug #33266)- Added a patch for yassl (bug #33814)- Updated to BK sources & GA man/info pages as was done in the centosplus release (thanks Johnny Hughes!). - Author's note: This release is basically functionally-identical to the centosplus release except that the 'mysql-libs' package is integrated into the main package.- Added "cluster" package using code from the centosplus release.- Added a patch to fix bug 31001 until 5.0.50 is released.- Updated to MySQL 5.0.48 - Added the stock multi-server init script to the init.d folder (manual config of the my.cnf required).- Updated to MySQL 5.0.46- Updated to MySQL 5.0.45- Updated to MySQL 5.0.44- Updated to MySQL 5.0.42- Updated to MySQL 5.0.41- Updated to MySQL 5.0.40 - Removed patch 10 as it isn't needed any more. - Removed a bunch of non-existent man pages.- Fixed yet another bug with the mysql-test package- Fixed a small packaging glitch that popped up for new installs of mysql- Updated to MySQL 5.0.38 - Removed patch #'s 1, 3, & 11 as they are no longer needed - Updated patch #'s 4, 5, & 8 to reflect file changes - Added 6 man pages to the server package, 6 to the test package, and 3 .sql files to the test package- Updated to MySQL 5.0.37 - Added patch #11 to undo a change that was recently committed that breaks the build during regression testing - Added 19 man pages to the mysql-server package- Updated to MySQL 5.0.36 - Fixed patch #4 (mysql-testing.patch) to reflect the Makefile.am changes made for this version - Fixed first entry in patch #10 (mysql-ssl-bugs.patch) and removed second and third because they have been fixed upstream - Removed patch #11 (mysql-y2007bug.patch) because it has been fixed upstream - Packaged mysql_install_db.1.gz & ndb_size.pl.1.gz into mysql-server- Update to MySQL 5.0.33 - Install band-aid fix for "view" regression test designed to fail after 2006 - Don't chmod -R the entire database directory tree on every startup Related: #221085 - Fix unsafe use of install-info Resolves: #223713 - Cope with new automake in F7 Resolves: #224171- Update to MySQL 5.0.27 (see CVE-2006-4031, CVE-2006-4226, CVE-2006-4227) Resolves: #202247, #202675, #203427, #203428, #203432, #203434, #208641 - Fix init script to return status 1 on server start timeout Resolves: #203910 - Move mysqldumpslow from base package to mysql-server Resolves: #193559 - Adjust link options for BDB module Resolves: #199368- rebuild- Work around brew's tendency not to clean up failed builds completely, by adding code in mysql-testing.patch to kill leftover mysql daemons.- Update to MySQL 5.0.22 (fixes CVE-2006-2753) - Install temporary workaround for gcc bug on s390x (bz #193912)- Fix bogus perl Requires for mysql-test- Update to MySQL 5.0.21- Modify multilib header hack to not break non-RH arches, per bug #181335 - Remove logrotate script, per bug #180639. - Add a new mysql-test RPM to carry the regression test files; hack up test scripts as needed to make them run in /usr/share/mysql-test.- bump again for double-long bug on ppc(64)- err-log option has been renamed to log-error, fix my.cnf and initscript- rebuilt for new gcc4.1 snapshot and glibc changes- Update to MySQL 5.0.18- fix my_config.h for ppc platforms- my_config.h needs to guard against 64-bit platforms that also define the 32-bit symbol- oops, looks like we want uname -i not uname -m- Update to MySQL 5.0.16 - Add EXCEPTIONS-CLIENT license info to the shipped documentation - Make my_config.h architecture-independent for multilib installs; put the original my_config.h into my_config_$ARCH.h - Add -fwrapv to CFLAGS so that gcc 4.1 doesn't break it- rebuilt- Make stop script wait for daemon process to disappear (bz#172426)- Rebuild due to openssl library update.- Update to MySQL 5.0.15 (scratch build for now)- Update to MySQL 4.1.14- Use politically correct patch name.- Fix buffer overflow newly exposed in isam code; it's the same issue previously found in myisam, and not very exciting, but I'm tired of seeing build warnings.- Update to MySQL 4.1.12 (includes a fix for bz#158688, bz#158689) - Extend mysql-test-ssl.patch to solve rpl_openssl test failure (bz#155850) - Update mysql-lock-ssl.patch to match the upstream committed version - Add --with-isam to re-enable the old ISAM table type, per bz#159262 - Add dependency on openssl-devel per bz#159569 - Remove manual.txt, as upstream decided not to ship it anymore; it was redundant with the mysql.info file anyway.- Include proper locking for OpenSSL in the server, per bz#155850- Enable openssl tests during build, per bz#155850 - Might as well turn on --disable-dependency-tracking- Avoid dependency on , cause it won't build anymore on ia64. This is probably a cleaner solution for bz#143537, too.- Update to MySQL 4.1.11 to fix bz#152911 as well as other issues - Move perl-DBI, perl-DBD-MySQL dependencies to server package (bz#154123) - Override configure thread library test to suppress HAVE_LINUXTHREADS check - Fix BDB failure on s390x (bz#143537) - At last we can enable "make test" on all arches- Update to MySQL 4.1.10a to fix security vulnerabilities (bz#150868, for CAN-2005-0711, and bz#150871 for CAN-2005-0709, CAN-2005-0710).- Fix package Requires: interdependencies.- Need -fno-strict-aliasing in at least one place, probably more. - Work around some C spec violations in mysql.- Update to MySQL 4.1.10.- Update to MySQL 4.1.9.- Don't assume /etc/my.cnf will specify pid-file (bz#143724)- Rebuilt for new readline.- Run make test on all archs except s390x (which seems to have a bdb issue)- Suppress someone's silly idea that libtool overhead can be skipped- Fix init script to not need a valid username for startup check (bz#142328) - Fix init script to honor settings appearing in /etc/my.cnf (bz#76051) - Enable SSL (bz#142032)- Add a restorecon to keep the mysql.log file in the right context (bz#143887)- Turn off old_passwords in default /etc/my.cnf file, for better compatibility with mysql 3.x clients (per suggestion from Joe Orton).- Handle ldconfig more cleanly (put a file in /etc/ld.so.conf.d/).- rebuild in devel branch- Update to MySQL 4.1.x.- fix security issues CAN-2004-0835, CAN-2004-0836, CAN-2004-0837 (bugs #135372, 135375, 135387) - fix privilege escalation on GRANT ALL ON `Foo\_Bar` (CAN-2004-0957)- fix multilib problem with mysqlbug and mysql_config - adjust chkconfig priority per bug #128852 - remove bogus quoting per bug #129409 (MySQL 4.0 has done likewise) - add sleep to mysql.init restart(); may or may not fix bug #133993- fix low-priority security issues CAN-2004-0388, CAN-2004-0381, CAN-2004-0457 (bugs #119442, 125991, 130347, 130348) - fix bug with dropping databases under recent kernels (bug #124352)- rebuilt- remove redundant INSTALL-SOURCE, manual.* - compress manual.txt.bz2 - BR time- repair logfile attributes in %files, per bug #102190 - repair quoting problem in mysqlhotcopy, per bug #112693 - repair missing flush in mysql_setpermission, per bug #113960 - repair broken error message printf, per bug #115165 - delete mysql user during uninstall, per bug #117017 - rebuilt- rebuilt- fix chown syntax in mysql.init - rebuild- rebuilt- update mysql.init to use anonymous user (UNKNOWN_MYSQL_USER) for pinging mysql server (#108779)- update mysql.init to wait (max 10 seconds) for mysql server to start (#58732)- re-enable Berkeley DB support (#106832) - re-enable ia64 testing- rebuilt- upgrade to 3.23.58 for security fix- rebuilt- revert to prior version of MySQL due to license incompatibilities with packages that link against the client. The MySQL folks are looking into the issue.- restrict test on ia64 (temporary)- rebuilt- fix filter-requires-mysql.sh with less restrictive for mysql-bench- update for MySQL 4.0 - back-level shared libraries available in mysqlclient10 package- add sql-bench package (#90110)- upgrade to 3.23.56 for security fixes - remove patch for double-free (included in 3.23.56)- enable thread safe client - add patch for double free fix- rebuilt- disable checks on s390x- use internal dep generator.- fix mysql_config on hammer- don't use rpms internal dep generator- Push it into the build system- upgrade to 3.23.54a for safe_mysqld fix- upgrade to 3.23.54 for latest security fixes- Always include for errno - Remove unpackaged files- do not prereq userdel, not used at all- Use %{_libdir} - Add patch for x86-64- rebuilt with gcc-3.2-7- Add --enable-local-infile to configure - a new option which doesn't default to the old behaviour (#72885)- 3.23.52. Fixes a minor security problem, various bugfixes.- rebuilt with gcc-3.2 (we hope)- rebuild- Fix #63543 and #63542- Turn off bdb on PPC(#68591) - Turn off the assembly optimizations, for safety.- Work around annoying auto* thinking this is a crosscompile - 3.23.51- automated rebuild- Add dependency on perl-DBI and perl-DBD-MySQL (#66349)- 3.23.50- automated rebuild- Rebuild - Don't set CXX to gcc, it doesn't work anymore - Exclude Alpha- Add the various .cnf examples as doc files to mysql-server (#60349) - Don't include manual.ps, it's just 200 bytes with a URL inside (#60349) - Don't include random files in /usr/share/mysql (#60349) - langify (#60349)- Rebuild- 3.23.49- work around perl dependency bug.- 3.23.48- Use kill, not mysqladmin, to flush logs and shut down. Thus, an admin password can be set with no problems. - Remove reload from init script- remove db3-devel from buildrequires, MySQL has had its own bundled copy since the mid thirties- 3.23.47 - Don't build for alpha, toolchain immature.- 3.23.46 - use -fno-rtti and -fno-exceptions, and set CXX to increase stability. Recommended by mysql developers.- 3.23.45- centralize definition of datadir in the initscript (#55873)- 3.23.44- 3.23.43- 3.23.42 - reenable innodb- 3.23.41 bugfix release - disable innodb, to avoid the broken updates - Use "mysqladmin flush_logs" instead of kill -HUP in logrotate script (#51711)- 3.23.40, bugfix release - Add zlib-devel to buildrequires:- BuildRequires-tweaking- Reenable test, but don't run them for s390, s390x or ia64 - Make /etc/my.cnf config(noplace). Same for /etc/logrotate.d/mysqld- 3.23.29 - enable innodb - enable assembly again - disable tests for now...- 3.23.38 - Don't use BDB on Alpha - no fast mutexes- 3.23.37 - Add _GNU_SOURCE to the compile flags- Make it obsolete our 6.2 PowerTools packages - 3.23.36 bugfix release - fixes some security issues which didn't apply to our standard configuration - Make "make test" part of the build process, except on IA64 (it fails there)- 3.23.35 bugfix release - Don't delete the mysql user on uninstall- 3.23.34a bugfix release- added readline-devel to BuildRequires:- small i18n-fixes to initscript (action needs $)- make it shut down and rotate logs without using mysqladmin (from #24909)- conflict with "MySQL"- improve gettextizing- 3.23.32 - fix logrotate script (#24589)- gettextize - move the items in Requires(post): to Requires: in preparation for an errata for 7.0 when 3.23.31 is released - 3.23.31- add the log file to the rpm database, and make it 0640 (#24116) - as above in logrotate script - changes to the init sequence - put most of the data in /etc/my.cnf instead of hardcoding in the init script - use /var/run/mysqld/mysqld.pid instead of /var/run/mysqld/pid - use standard safe_mysqld - shut down cleaner- 3.23.30 - do an explicit chmod on /var/lib/mysql in post, to avoid any problems with broken permissons. There is a report of rm not changing this on its own (#22989)- bzipped source - changed from 85 to 78 in startup, so it starts before apache (which can use modules requiring mysql)- 3.23.29a- add requirement for new libstdc++, build for errata- 3.23.29- 3.23.28 (gamma) - remove old patches, as they are now upstreamed- Add a requirement for a new glibc (#20735) - build on IA64- disable more assembly- fix mysql on SPARC (#20124)- 3.23.27- add patch for fixing bogus aliasing in mysql from Jakub, which should fix #18905 and #18620- check for negative niceness values, and negate it if present (#17899) - redefine optflags on IA32 FTTB- 3.23.26, which among other fixes now uses mkstemp() instead of tempnam(). - revert changes made yesterday, the problem is now isolated- use the compat C++ compiler FTTB. Argh. - add requirement of ncurses4 (see above)- 3.23.25 - fix shutdown problem (#17956)- Don't try to include no-longer-existing PUBLIC file as doc (#17532)- rename config file to /etc/my.cnf, which is what mysqld wants... doh. (#17432) - include a changed safe_mysqld, so the pid file option works. - make mysql dir world readable to they can access the mysql socket. (#17432) - 3.23.24- 3.23.23- Add "|| :" to condrestart to avoid non-zero exit code- it's mysql.com, not mysql.org and use correct path to source (#16830)- source file from /etc/rc.d, not /etc/rd.d. Doh.- don't run ldconfig -n, it doesn't update ld.so.cache (#16034) - include some missing binaries - use safe_mysqld to start the server (request from mysql developers)- condrestart fixes- 3.23.22. Disable the old patches, they're now in.- bugfixes in the initscript - move the .so link to the devel package- rebuild due to glibc changes- disable compiler patch - don't include info directory file- move back to /etc/rc.d/init.d- more cleanups in initscript- add a patch to work around compiler bug (from monty@mysql.com)- don't build the SQL daemon statically (glibc problems) - fix the logrotate script - only flush log if mysql is running - change the reloading procedure - remove icon - glint is obsolete a long time ago- automatic rebuild- try the new compiler again - build the SQL daemon statically - add compile time support for complex charsets - enable assembler - more cleanups in initscript- use old C++ compiler - Exclusivearch x86- move .so files to devel package - more cleanups - exclude sparc for now- 3.23.21 - remove file from /etc/sysconfig - Fix initscript a bit - initialization of databases doesn't work yet - specify the correct licenses - include a /etc/my.conf (empty, FTTB) - add conditional restart to spec file- Rebuild with new C++- update to 3.23.20 - use %configure, %makeinstall, %{_tmppath}, %{_mandir}, %{_infodir}, /etc/init.d - remove the bench package - change some of the descriptions a little bit - fix the init script - some compile fixes - specify mysql user - use mysql uid 27 (postgresql is 26) - don't build on ia64- Version 3.22.32 release XOS.1 for LinuX/OS 1.8.0 - Upgrade from version 3.22.27 to 3.22.32. - Do "make install" instead of "make install-strip", because "install -s" now appears to fail on various scripts. Afterwards, strip manually. - Reorganize subpackages, according to common Red Hat packages: the client program and shared library become the base package and the server and some accompanying files are now in a separate server package. The server package implicitly requires the base package (shared library), but we have added a manual require tag anyway (because of the shared config file, and more). - Rename the mysql-benchmark subpackage to mysql-bench.- Version 3.22.27 release XOS.2 for LinuX/OS 1.7.1 - Add post(un)install scripts for updating ld.so.conf (client subpackage).- Version 3.22.27 release XOS.1 for LinuX/OS 1.7.0 - Initial version. - Some ideas borrowed from Red Hat Powertools 6.1, although this spec file is a full rewrite from scratch./bin/sh/bin/sh/bin/sh/bin/shCentOS5-64-VM.XoxideInc.local 1208375135ic błbécbėbŌbŲbĪbĶbŹbŠbĻbīcbŚbŃbķbŪbÉb×bÖcböbģbüc#bųccbõci"i#i$i%i&i'aĘaćaæaŌa¹a°aÅaŅaĶaåa¾a²aøaźaÉa·aŻaĻaĄaÜaßaĢaąa¼aėaÓaµaęaįaŠa³aĀaĮaģa±cbŻc-c.c,c+c*bŽbßbąbįc3hžhśhü5.0.58-jason.25.0.58-jason.2 mysqldinnochecksummyisam_ftdumpmyisamchkmyisamlogmyisampackmysql_convert_table_formatmysql_explain_logmysql_fix_extensionsmysql_fix_privilege_tablesmysql_install_dbmysql_secure_installationmysql_setpermissionmysql_tzinfo_to_sqlmysql_upgrademysql_upgrade_shellmysql_zapmysqlbugmysqld_multimysqld_safemysqldumpslowmysqlhotcopymysqltestmysqltestmanagermysqltestmanager-pwgenmysqltestmanagercperrorreplaceresolve_stack_dumpresolveipmysqldmysqlmanagermysql-server-5.0.58my-huge.cnfmy-innodb-heavy-4G.cnfmy-large.cnfmy-medium.cnfmy-small.cnfinnochecksum.1.gzmsql2mysql.1.gzmyisam_ftdump.1.gzmyisamchk.1.gzmyisamlog.1.gzmyisampack.1.gzmysql.server.1.gzmysql_config.1.gzmysql_convert_table_format.1.gzmysql_explain_log.1.gzmysql_fix_extensions.1.gzmysql_fix_privilege_tables.1.gzmysql_install_db.1.gzmysql_secure_installation.1.gzmysql_setpermission.1.gzmysql_tzinfo_to_sql.1.gzmysql_upgrade.1.gzmysql_zap.1.gzmysqlbinlog.1.gzmysqlcheck.1.gzmysqld_multi.1.gzmysqld_safe.1.gzmysqlhotcopy.1.gzmysqlimport.1.gzmysqlman.1.gzmysqlmanager-pwgen.1.gzmysqlmanagerc.1.gzmysqltest.1.gzperror.1.gzreplace.1.gzresolve_stack_dump.1.gzresolveip.1.gzsafe_mysqld.1.gzmysqld.8.gzmysqlmanager.8.gzerrmsg.txtfill_help_tables.sqlmy-huge.cnfmy-innodb-heavy-4G.cnfmy-large.cnfmy-medium.cnfmy-small.cnfmysql_fix_privilege_tables.sqlmysql_system_tables.sqlmysql_system_tables_data.sqlmysql_test_data_timezone.sqlmysqld_multi.servermysqlmysqld.logmysqld/etc/rc.d/init.d//usr/bin//usr/libexec//usr/share/doc//usr/share/doc/mysql-server-5.0.58//usr/share/man/man1//usr/share/man/man8//usr/share/mysql//var/lib//var/log//var/run/-O2 -gcpiogzip9x86_64x86_64-redhat-linux      ASCII English textASCII English text, with very long linesASCII text, with very long linesBourne shell script text executableBourne-Again shell script text executableELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), not strippedNon-ISO extended-ASCII English text, with very long lines, with LF, NEL line terminators, with escape sequencesdirectoryemptyperl script text executable ".:=BCDEFKWbcdgjknxƒ‘œ§±¼ĘŠęų    RR R R RRRRR"R4R R R R RRRRRRR"R4R R R R RRRRRRR"R4R R R R RRRRRRR"R4R R R R RRRRRRR"R4RR$R*RR$R*R-R/RRRRRR$R*R-R.R R R RRRRRRRR"R4R R R RRRRRRR"R4RRR R R4RR*R+RRR*R-RR$R%R&R'R(R)R*R,R-R R R RRRRRRR"R4R R R RRRRRRRRRR"R4R R R RRRRRRR"R4R R R RRRRRRR"R4R R R RRRRRR"R4R R R R RRRRRR"R4R R R RRRRRR"R4R R R RRRRRR"R4R R R R RRRRRRRRRRRRRRR R!R"R4R R R R RRRRRRRRRRR R!R"R4Ró¬Å~r€),5?āÜp.system_u:object_r:initrc_exec_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:mysqld_exec_tsystem_u:object_r:bin_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:mysqld_db_tsystem_u:object_r:mysqld_log_tsystem_u:object_r:mysqld_var_run_t=’’ū`